![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
![]() | Superfamily b.60.1: Lipocalins [50814] (10 families) ![]() bind hydrophobic ligands in their interior |
![]() | Family b.60.1.8: Rv2717c-like [141475] (3 proteins) bacterial and plant proteins with a fatty acid binding protein-like fold automatically mapped to Pfam PF08768 |
![]() | Protein Hypothetical protein Rv2717c [141476] (1 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [141477] (3 PDB entries) Uniprot O07216 4-164 |
![]() | Domain d2fr2a1: 2fr2 A:4-164 [133963] |
PDB Entry: 2fr2 (more details), 1.5 Å
SCOPe Domain Sequences for d2fr2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fr2a1 b.60.1.8 (A:4-164) Hypothetical protein Rv2717c {Mycobacterium tuberculosis [TaxId: 1773]} dlapalqalspllgswagrgagkyptirpfeyleevvfahvgkpfltytqqtravadgkp lhsetgylrvcrpgcvelvlahpsgiteievgtysvtgdvielelstradgsiglaptak evtaldrsyridgdelsyslqmravgqplqdhlaavlhrqr
Timeline for d2fr2a1: