Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
Protein Erythromycin synthase, eryAI, 1st ketoreductase module [141909] (1 species) tandem repeat of two SDR-like modules resembling a dimer commonly founf in the family; only the second module retains the coenzyme-binding site |
Species Saccharopolyspora erythraea [TaxId:1836] [141910] (4 PDB entries) Uniprot Q5UNP6 1448-1656! Uniprot Q5UNP6 1657-1915 |
Domain d2fr0a1: 2fr0 A:1657-1915 [133959] complexed with ndp |
PDB Entry: 2fr0 (more details), 1.81 Å
SCOPe Domain Sequences for d2fr0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fr0a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} atddewkptgtvlvtggtggvggqiarwlarrgaphlllvsrsgpdadgagelvaeleal garttvaacdvtdresvrellggigddvplsavfhaaatlddgtvdtltgerierasrak vlgarnlheltreldltafvlfssfasafgapglggyapgnayldglaqqrrsdglpata vawgtwagsgmaegpvadrfrrhgviemppetacralqnaldraevcpividvrwdrfll aytaqrptrlfdeiddarr
Timeline for d2fr0a1: