Lineage for d2fr0a1 (2fr0 A:1657-1915)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 686289Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 686793Protein Erythromycin synthase, eryAI, 1st ketoreductase module [141909] (1 species)
    tandem repeat of two SDR-like modules resembling a dimer commonly founf in the family; only the second module retains the coenzyme-binding site
  7. 686794Species Saccharopolyspora erythraea [TaxId:1836] [141910] (2 PDB entries)
  8. 686797Domain d2fr0a1: 2fr0 A:1657-1915 [133959]
    complexed with ndp

Details for d2fr0a1

PDB Entry: 2fr0 (more details), 1.81 Å

PDB Description: The first ketoreductase of the erythromycin synthase (crystal form 1)
PDB Compounds: (A:) Erythromycin synthase, EryAI

SCOP Domain Sequences for d2fr0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fr0a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]}
atddewkptgtvlvtggtggvggqiarwlarrgaphlllvsrsgpdadgagelvaeleal
garttvaacdvtdresvrellggigddvplsavfhaaatlddgtvdtltgerierasrak
vlgarnlheltreldltafvlfssfasafgapglggyapgnayldglaqqrrsdglpata
vawgtwagsgmaegpvadrfrrhgviemppetacralqnaldraevcpividvrwdrfll
aytaqrptrlfdeiddarr

SCOP Domain Coordinates for d2fr0a1:

Click to download the PDB-style file with coordinates for d2fr0a1.
(The format of our PDB-style files is described here.)

Timeline for d2fr0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fr0a2