Lineage for d2fqta1 (2fqt A:4-157)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 739189Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 739190Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 739408Family d.185.1.2: Autoinducer-2 production protein LuxS [64294] (1 protein)
    contains additional N-terminal strand; possible relationships to the putative editing domain of ThrRS (d.67.1)
  6. 739409Protein Autoinducer-2 production protein LuxS [64295] (4 species)
    S-ribosylhomocysteinase
  7. 739410Species Bacillus subtilis [TaxId:1423] [64296] (6 PDB entries)
  8. 739413Domain d2fqta1: 2fqt A:4-157 [133958]
    automatically matched to d1ie0a_
    complexed with co, h1d, so4

Details for d2fqta1

PDB Entry: 2fqt (more details), 1.79 Å

PDB Description: Crystal structure of B.subtilis LuxS in complex with (2S)-2-Amino-4-[(2R,3S)-2,3-dihydroxy-3-N-hydroxycarbamoyl-propylmercapto]butyric acid
PDB Compounds: (A:) S-ribosylhomocysteine lyase

SCOP Domain Sequences for d2fqta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fqta1 d.185.1.2 (A:4-157) Autoinducer-2 production protein LuxS {Bacillus subtilis [TaxId: 1423]}
vesfeldhnavvapyvrhcgvhkvgtdgvvnkfdirfcqpnkqamkpdtihtlehllaft
irshaekydhfdiidispmgcqtgyylvvsgeptsaeivdlledtmkeaveiteipaane
kqcgqaklhdlegakrlmrfwlsqdkeellkvfg

SCOP Domain Coordinates for d2fqta1:

Click to download the PDB-style file with coordinates for d2fqta1.
(The format of our PDB-style files is described here.)

Timeline for d2fqta1: