Lineage for d2fqoa_ (2fqo A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1684578Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 1684579Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 1684819Family d.185.1.2: Autoinducer-2 production protein LuxS [64294] (1 protein)
    contains additional N-terminal strand; possible relationships to the putative editing domain of ThrRS (d.67.1)
    automatically mapped to Pfam PF02664
  6. 1684820Protein Autoinducer-2 production protein LuxS [64295] (4 species)
    S-ribosylhomocysteinase
  7. 1684821Species Bacillus subtilis [TaxId:1423] [64296] (7 PDB entries)
  8. 1684825Domain d2fqoa_: 2fqo A: [133957]
    automated match to d1ie0a_
    complexed with co, hyi, so4

Details for d2fqoa_

PDB Entry: 2fqo (more details), 1.87 Å

PDB Description: Crystal structure of B. subtilis LuxS in complex with (2S)-2-Amino-4-[(2R,3R)-2,3-dihydroxy-3-N- hydroxycarbamoyl-propylmercapto]butyric acid
PDB Compounds: (A:) S-ribosylhomocysteine lyase

SCOPe Domain Sequences for d2fqoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fqoa_ d.185.1.2 (A:) Autoinducer-2 production protein LuxS {Bacillus subtilis [TaxId: 1423]}
vesfeldhnavvapyvrhcgvhkvgtdgvvnkfdirfcqpnkqamkpdtihtlehllaft
irshaekydhfdiidispmgcqtgyylvvsgeptsaeivdlledtmkeaveiteipaane
kqcgqaklhdlegakrlmrfwlsqdkeellkvfg

SCOPe Domain Coordinates for d2fqoa_:

Click to download the PDB-style file with coordinates for d2fqoa_.
(The format of our PDB-style files is described here.)

Timeline for d2fqoa_: