![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies) alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet |
![]() | Superfamily d.82.2: Frataxin/Nqo15-like [55387] (3 families) ![]() |
![]() | Family d.82.2.1: Frataxin-like [55388] (3 proteins) iron homeostasis proteins automatically mapped to Pfam PF01491 |
![]() | Protein C-terminal domain of frataxin [55389] (2 species) protein responsible for Friedreich ataxia |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [143571] (5 PDB entries) Uniprot Q07540 52-174! Uniprot Q07540 61-172 |
![]() | Domain d2fqla1: 2fql A:61-172 [133956] |
PDB Entry: 2fql (more details), 3.01 Å
SCOPe Domain Sequences for d2fqla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fqla1 d.82.2.1 (A:61-172) C-terminal domain of frataxin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} vpqevlnlplekaheeaddyldhlldsleelseahpdcipdvelshgvmtleipafgtyv inkqppnkqiwlasplsgpnrfdllngewvslrngtkltdilteevekaisk
Timeline for d2fqla1: