SCOPe 2.07: Domain d2fqla1: 2fql A:61-172

Lineage for d2fqla1 (2fql A:61-172)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
   alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet

4. Superfamily d.82.2: Frataxin/Nqo15-like [55387] (3 families)

5. Family d.82.2.1: Frataxin-like [55388] (3 proteins)
   iron homeostasis proteins
   automatically mapped to Pfam PF01491

6. Protein C-terminal domain of frataxin [55389] (2 species)
   protein responsible for Friedreich ataxia

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [143571] (5 PDB entries)
   Uniprot Q07540 52-174! Uniprot Q07540 61-172

8. Domain d2fqla1: 2fql A:61-172 [133956]

Details for d2fqla1

PDB Entry: 2fql, 3.01 Å

PDB Description: crystal structure of trimeric frataxin from the yeast saccharomyces cerevisiae

PDB Compounds: (A:) Frataxin homolog, mitochondrial

SCOPe Domain Sequences for d2fqla1:

Sequence; same for both SEQRES and ATOM records:

>d2fqla1 d.82.2.1 (A:61-172) C-terminal domain of frataxin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vpqevlnlplekaheeaddyldhlldsleelseahpdcipdvelshgvmtleipafgtyv
inkqppnkqiwlasplsgpnrfdllngewvslrngtkltdilteevekaisk

Timeline for d2fqla1:

• d2fqla1 first appeared in SCOP 1.73
  
• d2fqla1 appears in SCOPe 2.06
  
• d2fqla1 appears in the current release, SCOPe 2.08