Lineage for d2fqla1 (2fql A:61-172)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2527780Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
    alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet
  4. 2527817Superfamily d.82.2: Frataxin/Nqo15-like [55387] (3 families) (S)
  5. 2527818Family d.82.2.1: Frataxin-like [55388] (3 proteins)
    iron homeostasis proteins
    automatically mapped to Pfam PF01491
  6. 2527819Protein C-terminal domain of frataxin [55389] (2 species)
    protein responsible for Friedreich ataxia
  7. 2527820Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [143571] (5 PDB entries)
    Uniprot Q07540 52-174! Uniprot Q07540 61-172
  8. 2527822Domain d2fqla1: 2fql A:61-172 [133956]

Details for d2fqla1

PDB Entry: 2fql (more details), 3.01 Å

PDB Description: crystal structure of trimeric frataxin from the yeast saccharomyces cerevisiae
PDB Compounds: (A:) Frataxin homolog, mitochondrial

SCOPe Domain Sequences for d2fqla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fqla1 d.82.2.1 (A:61-172) C-terminal domain of frataxin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vpqevlnlplekaheeaddyldhlldsleelseahpdcipdvelshgvmtleipafgtyv
inkqppnkqiwlasplsgpnrfdllngewvslrngtkltdilteevekaisk

SCOPe Domain Coordinates for d2fqla1:

Click to download the PDB-style file with coordinates for d2fqla1.
(The format of our PDB-style files is described here.)

Timeline for d2fqla1: