Lineage for d2fqga1 (2fqg A:31-170)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2043106Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2043107Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2043852Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2043977Protein multi-copper oxidase CueO [69194] (1 species)
  7. 2043978Species Escherichia coli [TaxId:562] [69195] (34 PDB entries)
  8. 2044072Domain d2fqga1: 2fqg A:31-170 [133952]
    automated match to d1kv7a1
    complexed with c2o, cit, cu, na, pge

Details for d2fqga1

PDB Entry: 2fqg (more details), 2.3 Å

PDB Description: crystal structures of e. coli laccase cueo under different copper binding situations
PDB Compounds: (A:) Blue copper oxidase cueO

SCOPe Domain Sequences for d2fqga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fqga1 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}
rptlpipdllttdarnriqltigagqstfggktattwgyngnllgpavklqrgkavtvdi
ynqlteettlhwhglevpgevdggpqgiippggkrsvtlnvdqpaatcwfhphqhgktgr
qvamglaglvvieddeilkl

SCOPe Domain Coordinates for d2fqga1:

Click to download the PDB-style file with coordinates for d2fqga1.
(The format of our PDB-style files is described here.)

Timeline for d2fqga1: