Class b: All beta proteins [48724] (177 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins) |
Protein multi-copper oxidase CueO [69194] (1 species) |
Species Escherichia coli [TaxId:562] [69195] (34 PDB entries) |
Domain d2fqga1: 2fqg A:31-170 [133952] automated match to d1kv7a1 complexed with c2o, cit, cu, na, pge |
PDB Entry: 2fqg (more details), 2.3 Å
SCOPe Domain Sequences for d2fqga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fqga1 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} rptlpipdllttdarnriqltigagqstfggktattwgyngnllgpavklqrgkavtvdi ynqlteettlhwhglevpgevdggpqgiippggkrsvtlnvdqpaatcwfhphqhgktgr qvamglaglvvieddeilkl
Timeline for d2fqga1: