Lineage for d2fqfa3 (2fqf A:336-516)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. Protein multi-copper oxidase CueO, C-terminal domain [418909] (1 species)
  7. Species Escherichia coli [TaxId:562] [419323] (38 PDB entries)
  8. Domain d2fqfa3: 2fqf A:336-516 [133951]
    Other proteins in same PDB: d2fqfa1, d2fqfa2
    automated match to d1kv7a3
    complexed with c2o, cit, cu

    has additional insertions and/or extensions that are not grouped together

Details for d2fqfa3

PDB Entry: 2fqf (more details), 2 Å

PDB Description: crystal structures of e. coli laccase cueo under different copper binding situations
PDB Compounds: (A:) Blue copper oxidase cueO

SCOPe Domain Sequences for d2fqfa3:

Sequence, based on SEQRES records: (download)

>d2fqfa3 b.6.1.3 (A:336-516) multi-copper oxidase CueO, C-terminal domain {Escherichia coli [TaxId: 562]}
slpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagmdhsqmmghmghgnmnh
mnhggkfdfhhankingqafdmnkpmfaaakgqyerwvisgvgdmmlhpfhihgtqfril
sengkppaahragwkdtvkvegnvsevlvkfnhdapkehaymahchllehedtgmmlgft
v

Sequence, based on observed residues (ATOM records): (download)

>d2fqfa3 b.6.1.3 (A:336-516) multi-copper oxidase CueO, C-terminal domain {Escherichia coli [TaxId: 562]}
slpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagmdfdfhhankingqafd
mnkpmfaaakgqyerwvisgvgdmmlhpfhihgtqfrilsengkppaahragwkdtvkve
gnvsevlvkfnhdapkehaymahchllehedtgmmlgftv

SCOPe Domain Coordinates for d2fqfa3 are not available.

Timeline for d2fqfa3:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fqfa1, d2fqfa2