Class b: All beta proteins [48724] (174 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (7 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins) |
Protein multi-copper oxidase CueO [69194] (1 species) |
Species Escherichia coli [TaxId:562] [69195] (7 PDB entries) |
Domain d2fqfa2: 2fqf A:171-335 [133950] automatically matched to d1kv7a2 complexed with c2o, cit, cu |
PDB Entry: 2fqf (more details), 2 Å
SCOP Domain Sequences for d2fqfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fqfa2 b.6.1.3 (A:171-335) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} mlpkqwgiddvpvivqdkkfsadgqidyqldvmtaavgwfgdtlltngaiypqhaaprgw lrlrllngcnarslnfatsdnrplyviasdggllpepvkvselpvlmgerfevlvevndn kpfdlvtlpvsqmgmaiapfdkphpvmriqpiaisasgalpdtls
Timeline for d2fqfa2: