SCOPe 2.08: Domain d2fqfa1: 2fqf A:31-170

Lineage for d2fqfa1 (2fqf A:31-170)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)

6. Protein multi-copper oxidase CueO, N- and middle domain [418908] (1 species)

7. Species Escherichia coli [TaxId:562] [419322] (38 PDB entries)

8. Domain d2fqfa1: 2fqf A:31-170 [133949]
   Other proteins in same PDB: d2fqfa3
   automated match to d1kv7a1
   complexed with c2o, cit, cu

Details for d2fqfa1

PDB Entry: 2fqf, 2 Å

PDB Description: crystal structures of e. coli laccase cueo under different copper binding situations

PDB Compounds: (A:) Blue copper oxidase cueO

SCOPe Domain Sequences for d2fqfa1:

Sequence; same for both SEQRES and ATOM records:

>d2fqfa1 b.6.1.3 (A:31-170) multi-copper oxidase CueO, N- and middle domain {Escherichia coli [TaxId: 562]}
rptlpipdllttdarnriqltigagqstfggktattwgyngnllgpavklqrgkavtvdi
ynqlteettlhwhglevpgevdggpqgiippggkrsvtlnvdqpaatcwfhphqhgktgr
qvamglaglvvieddeilkl

Timeline for d2fqfa1:

• d2fqfa1 first appeared in SCOP 1.73
  
• d2fqfa1 appears in SCOPe 2.07