SCOP 1.75: Domain d2fqea3: 2fqe A:336-516

Lineage for d2fqea3 (2fqe A:336-516)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (7 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)

6. Protein multi-copper oxidase CueO [69194] (1 species)

7. Species Escherichia coli [TaxId:562] [69195] (7 PDB entries)

8. Domain d2fqea3: 2fqe A:336-516 [133948]
   automatically matched to d1kv7a3
   complexed with c2o, cit, cu, na

Details for d2fqea3

PDB Entry: 2fqe, 1.92 Å

PDB Description: crystal structures of e. coli laccase cueo under different copper binding situations

PDB Compounds: (A:) Blue copper oxidase cueO

SCOP Domain Sequences for d2fqea3:

Sequence, based on SEQRES records:

>d2fqea3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}
slpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagmdhsqmmghmghgnmnh
mnhggkfdfhhankingqafdmnkpmfaaakgqyerwvisgvgdmmlhpfhihgtqfril
sengkppaahragwkdtvkvegnvsevlvkfnhdapkehaymahchllehedtgmmlgft
v

Sequence, based on observed residues (ATOM records):

>d2fqea3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}
slpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagmdfhhankingqafdmn
kpmfaaakgqyerwvisgvgdmmlhpfhihgtqfrilsengkppaahragwkdtvkvegn
vsevlvkfnhdapkehaymahchllehedtgmmlgftv

Timeline for d2fqea3:

• d2fqea3 first appeared in SCOP 1.73
  
• d2fqea3 appears in SCOPe 2.01
  
• d2fqea3 appears in the current release, SCOPe 2.08