SCOPe 2.04: Domain d2fqda3: 2fqd A:336-516

Lineage for d2fqda3 (2fqd A:336-516)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein multi-copper oxidase CueO [69194] (1 species)

7. Species Escherichia coli [TaxId:562] [69195] (29 PDB entries)

8. Domain d2fqda3: 2fqd A:336-516 [133945]
   automated match to d1n68a3
   complexed with c2o, cit, cu

Details for d2fqda3

PDB Entry: 2fqd, 2.4 Å

PDB Description: crystal structures of e. coli laccase cueo under different copper binding situations

PDB Compounds: (A:) Blue copper oxidase cueO

SCOPe Domain Sequences for d2fqda3:

Sequence, based on SEQRES records:

>d2fqda3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}
slpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagmdhsqmmghmghgnmnh
mnhggkfdfhhankingqafdmnkpmfaaakgqyerwvisgvgdmmlhpfhihgtqfril
sengkppaahragwkdtvkvegnvsevlvkfnhdapkehaymahchllehedtgmmlgft
v

Sequence, based on observed residues (ATOM records):

>d2fqda3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}
slpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagfdfhhankingqafdmn
kpmfaaakgqyerwvisgvgdmmlhpfhihgtqfrilsengkppaahragwkdtvkvegn
vsevlvkfnhdapkehaymahchllehedtgmmlgftv

Timeline for d2fqda3:

• d2fqda3 first appeared in SCOP 1.73
  
• d2fqda3 appears in SCOPe 2.03
  
• d2fqda3 appears in SCOPe 2.05
  
• d2fqda3 appears in the current release, SCOPe 2.08