Lineage for d2fqda2 (2fqd A:171-335)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 660498Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 660499Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 660887Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 660981Protein multi-copper oxidase CueO [69194] (1 species)
  7. 660982Species Escherichia coli [TaxId:562] [69195] (7 PDB entries)
  8. 661002Domain d2fqda2: 2fqd A:171-335 [133944]
    automatically matched to d1kv7a2
    complexed with c2o, cit, cu

Details for d2fqda2

PDB Entry: 2fqd (more details), 2.4 Å

PDB Description: crystal structures of e. coli laccase cueo under different copper binding situations
PDB Compounds: (A:) Blue copper oxidase cueO

SCOP Domain Sequences for d2fqda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fqda2 b.6.1.3 (A:171-335) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}
mlpkqwgiddvpvivqdkkfsadgqidyqldvmtaavgwfgdtlltngaiypqhaaprgw
lrlrllngcnarslnfatsdnrplyviasdggllpepvkvselpvlmgerfevlvevndn
kpfdlvtlpvsqmgmaiapfdkphpvmriqpiaisasgalpdtls

SCOP Domain Coordinates for d2fqda2:

Click to download the PDB-style file with coordinates for d2fqda2.
(The format of our PDB-style files is described here.)

Timeline for d2fqda2: