Lineage for d2fq4a2 (2fq4 A:78-192)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
multihelical; interlocked (homo)dimerSuperfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) 
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) 
Protein Transcriptional regulator BC3163 [140907] (1 species) Species Bacillus cereus [TaxId:1396] [140908] (1 PDB entry)
Uniprot Q81BJ4 78-192
Domain d2fq4a2: 2fq4 A:78-192 [133938]
Other proteins in same PDB: d2fq4a1
Details for d2fq4a2
PDB Entry: 2fq4 (more details), 1.79 Å
PDB Description: the crystal structure of the transcriptional regulator (tetr family) from bacillus cereus
PDB Compounds: (A:) TRANSCRIPTIONAL REGULATOR, TetR FAMILYSCOPe Domain Sequences for d2fq4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fq4a2 a.121.1.1 (A:78-192) Transcriptional regulator BC3163 {Bacillus cereus [TaxId: 1396]}
gsalndilihatslanflisregtiinelvgegqfdsklaeeyrvryfqprrlqakqlle
kgikrgelkenldielsidliygpifyrllvtgeklddsyvhdlvinafegirlr
SCOPe Domain Coordinates for d2fq4a2:
Click to download the PDB-style file with coordinates for d2fq4a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fq4a2:
- d2fq4a2 first appeared in SCOP 1.73
- d2fq4a2 appears in SCOPe 2.07
View in 3D
