Lineage for d2fq4a2 (2fq4 A:78-192)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008141Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2008142Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2008143Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 protein domains)
  6. 2008390Protein Transcriptional regulator BC3163 [140907] (1 species)
  7. 2008391Species Bacillus cereus [TaxId:1396] [140908] (1 PDB entry)
    Uniprot Q81BJ4 78-192
  8. 2008392Domain d2fq4a2: 2fq4 A:78-192 [133938]
    Other proteins in same PDB: d2fq4a1

Details for d2fq4a2

PDB Entry: 2fq4 (more details), 1.79 Å

PDB Description: The crystal structure of the transcriptional regulator (TetR family) from Bacillus cereus
PDB Compounds: (A:) TRANSCRIPTIONAL REGULATOR, TetR FAMILY

SCOPe Domain Sequences for d2fq4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fq4a2 a.121.1.1 (A:78-192) Transcriptional regulator BC3163 {Bacillus cereus [TaxId: 1396]}
gsalndilihatslanflisregtiinelvgegqfdsklaeeyrvryfqprrlqakqlle
kgikrgelkenldielsidliygpifyrllvtgeklddsyvhdlvinafegirlr

SCOPe Domain Coordinates for d2fq4a2:

Click to download the PDB-style file with coordinates for d2fq4a2.
(The format of our PDB-style files is described here.)

Timeline for d2fq4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fq4a1