Lineage for d2fq4a1 (2fq4 A:9-77)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981148Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1981577Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 protein domains)
  6. 1981816Protein Transcriptional regulator BC3163 [140175] (1 species)
  7. 1981817Species Bacillus cereus [TaxId:1396] [140176] (1 PDB entry)
    Uniprot Q81BJ4 9-77
  8. 1981818Domain d2fq4a1: 2fq4 A:9-77 [133937]
    Other proteins in same PDB: d2fq4a2

Details for d2fq4a1

PDB Entry: 2fq4 (more details), 1.79 Å

PDB Description: The crystal structure of the transcriptional regulator (TetR family) from Bacillus cereus
PDB Compounds: (A:) TRANSCRIPTIONAL REGULATOR, TetR FAMILY

SCOPe Domain Sequences for d2fq4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fq4a1 a.4.1.9 (A:9-77) Transcriptional regulator BC3163 {Bacillus cereus [TaxId: 1396]}
rnietqkailsasyelllesgfkavtvdkiaerakvskatiykwwpnkaavvmdgflsaa
aarlpvpdt

SCOPe Domain Coordinates for d2fq4a1:

Click to download the PDB-style file with coordinates for d2fq4a1.
(The format of our PDB-style files is described here.)

Timeline for d2fq4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fq4a2