Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
Protein Transcriptional regulator BC3163 [140175] (1 species) |
Species Bacillus cereus [TaxId:1396] [140176] (1 PDB entry) Uniprot Q81BJ4 9-77 |
Domain d2fq4a1: 2fq4 A:9-77 [133937] Other proteins in same PDB: d2fq4a2 |
PDB Entry: 2fq4 (more details), 1.79 Å
SCOPe Domain Sequences for d2fq4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fq4a1 a.4.1.9 (A:9-77) Transcriptional regulator BC3163 {Bacillus cereus [TaxId: 1396]} rnietqkailsasyelllesgfkavtvdkiaerakvskatiykwwpnkaavvmdgflsaa aarlpvpdt
Timeline for d2fq4a1: