Lineage for d2fpzd_ (2fpz D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1793331Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 1793447Protein beta-Tryptase [50546] (1 species)
    ring-like tetramer with active sites facing a central pore
  7. 1793448Species Human (Homo sapiens) [TaxId:9606] [50547] (18 PDB entries)
  8. 1793456Domain d2fpzd_: 2fpz D: [133935]
    automated match to d1a0la_
    complexed with 270

Details for d2fpzd_

PDB Entry: 2fpz (more details), 2 Å

PDB Description: Human tryptase with 2-amino benzimidazole
PDB Compounds: (D:) Tryptase beta-2

SCOPe Domain Sequences for d2fpzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fpzd_ b.47.1.2 (D:) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]}
ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
vpk

SCOPe Domain Coordinates for d2fpzd_:

Click to download the PDB-style file with coordinates for d2fpzd_.
(The format of our PDB-style files is described here.)

Timeline for d2fpzd_: