SCOPe 2.07: Domain d2fpzc_: 2fpz C:

Lineage for d2fpzc_ (2fpz C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein beta-Tryptase [50546] (1 species)
   ring-like tetramer with active sites facing a central pore

7. Species Human (Homo sapiens) [TaxId:9606] [50547] (22 PDB entries)

8. Domain d2fpzc_: 2fpz C: [133934]
   automated match to d1a0la_
   complexed with 270

Details for d2fpzc_

PDB Entry: 2fpz, 2 Å

PDB Description: Human tryptase with 2-amino benzimidazole

PDB Compounds: (C:) Tryptase beta-2

SCOPe Domain Sequences for d2fpzc_:

Sequence; same for both SEQRES and ATOM records:

>d2fpzc_ b.47.1.2 (C:) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]}
ivggqeaprskwpwqvslrvhgpywmhfcggslihpqwvltaahcvgpdvkdlaalrvql
reqhlyyqdqllpvsriivhpqfytaqigadialleleepvkvsshvhtvtlppasetfp
pgmpcwvtgwgdvdnderlpppfplkqvkvpimenhicdakyhlgaytgddvrivrddml
cagntrrdscqgdsggplvckvngtwlqagvvswgegcaqpnrpgiytrvtyyldwihhy
vpk

Timeline for d2fpzc_:

• d2fpzc_ first appeared in SCOP 1.73, called d2fpzc1
  
• d2fpzc_ appears in SCOPe 2.06
  
• d2fpzc_ appears in the current release, SCOPe 2.08