Lineage for d2fpxa1 (2fpx A:3-163)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 712195Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 712196Superfamily c.108.1: HAD-like [56784] (23 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 712564Family c.108.1.19: Histidinol phosphatase [142177] (1 protein)
    no insertion subdomains
  6. 712565Protein Histidine biosynthesis bifunctional protein HisB, phosphatase domain [142178] (1 species)
  7. 712566Species Escherichia coli [TaxId:562] [142179] (5 PDB entries)
  8. 712571Domain d2fpxa1: 2fpx A:3-163 [133929]
    automatically matched to 2FPR A:3-163
    complexed with mg, so4, zn

Details for d2fpxa1

PDB Entry: 2fpx (more details), 1.8 Å

PDB Description: crystal structure of the n-terminal domain of e.coli hisb- sulfate complex.
PDB Compounds: (A:) Histidine biosynthesis bifunctional protein hisB

SCOP Domain Sequences for d2fpxa1:

Sequence, based on SEQRES records: (download)

>d2fpxa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]}
sqkylfidrdgtliseppsdfqvdrfdklafepgvipqllklqkagyklvmitnqdglgt
qsfpqadfdgphnlmmqiftsqgvqfdevlicphlpadecdcrkpkvklverylaeqamd
ransyvigdratdiqlaenmginglrydretlnwpmigeql

Sequence, based on observed residues (ATOM records): (download)

>d2fpxa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]}
sqkylfidrdgtlisepdfqvdrfdklafepgvipqllklqkagyklvmitnqdglgtqs
fpqadfdgphnlmmqiftsqgvqfdevlicphlpadecdcrkpkvklverylmdransyv
igdratdiqlaenmginglrydretlnwpmigeql

SCOP Domain Coordinates for d2fpxa1:

Click to download the PDB-style file with coordinates for d2fpxa1.
(The format of our PDB-style files is described here.)

Timeline for d2fpxa1: