Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.19: Histidinol phosphatase-like [142177] (3 proteins) no insertion subdomains |
Protein Histidine biosynthesis bifunctional protein HisB, phosphatase domain [142178] (1 species) |
Species Escherichia coli [TaxId:562] [142179] (5 PDB entries) Uniprot Q9S5G5 3-163 |
Domain d2fpwb_: 2fpw B: [133928] automated match to d2fpra1 complexed with ca, zn |
PDB Entry: 2fpw (more details), 1.75 Å
SCOPe Domain Sequences for d2fpwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fpwb_ c.108.1.19 (B:) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} qkylfidrdgtliseppsdfqvdrfdklafepgvipqllklqkagyklvmitnqdglgtq sfpqadfdgphnlmmqiftsqgvqfdevlicphlpadecdcrkpkvklverylaeqamdr ansyvigdratdiqlaenmginglrydretlnwpmigeqltrr
Timeline for d2fpwb_: