SCOPe 2.05: Domain d2fpwb_: 2fpw B:

Lineage for d2fpwb_ (2fpw B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.19: Histidinol phosphatase-like [142177] (3 proteins)
   no insertion subdomains

6. Protein Histidine biosynthesis bifunctional protein HisB, phosphatase domain [142178] (1 species)

7. Species Escherichia coli [TaxId:562] [142179] (5 PDB entries)
   Uniprot Q9S5G5 3-163

8. Domain d2fpwb_: 2fpw B: [133928]
   automated match to d2fpra1
   complexed with ca, zn

Details for d2fpwb_

PDB Entry: 2fpw, 1.75 Å

PDB Description: crystal structure of the n-terminal domain of e.coli hisb- phosphoaspartate intermediate.

PDB Compounds: (B:) Histidine biosynthesis bifunctional protein hisB

SCOPe Domain Sequences for d2fpwb_:

Sequence; same for both SEQRES and ATOM records:

>d2fpwb_ c.108.1.19 (B:) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]}
qkylfidrdgtliseppsdfqvdrfdklafepgvipqllklqkagyklvmitnqdglgtq
sfpqadfdgphnlmmqiftsqgvqfdevlicphlpadecdcrkpkvklverylaeqamdr
ansyvigdratdiqlaenmginglrydretlnwpmigeqltrr

Timeline for d2fpwb_:

• d2fpwb_ first appeared in SCOP 1.73, called d2fpwb1
  
• d2fpwb_ appears in SCOPe 2.04
  
• d2fpwb_ appears in SCOPe 2.06
  
• d2fpwb_ appears in the current release, SCOPe 2.08