Lineage for d2fpwb1 (2fpw B:4-163)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 712195Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 712196Superfamily c.108.1: HAD-like [56784] (23 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 712564Family c.108.1.19: Histidinol phosphatase [142177] (1 protein)
    no insertion subdomains
  6. 712565Protein Histidine biosynthesis bifunctional protein HisB, phosphatase domain [142178] (1 species)
  7. 712566Species Escherichia coli [TaxId:562] [142179] (5 PDB entries)
  8. 712570Domain d2fpwb1: 2fpw B:4-163 [133928]
    automatically matched to 2FPR A:3-163
    complexed with ca, phd, zn

Details for d2fpwb1

PDB Entry: 2fpw (more details), 1.75 Å

PDB Description: crystal structure of the n-terminal domain of e.coli hisb- phosphoaspartate intermediate.
PDB Compounds: (B:) Histidine biosynthesis bifunctional protein hisB

SCOP Domain Sequences for d2fpwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fpwb1 c.108.1.19 (B:4-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]}
qkylfidrdgtliseppsdfqvdrfdklafepgvipqllklqkagyklvmitnqdglgtq
sfpqadfdgphnlmmqiftsqgvqfdevlicphlpadecdcrkpkvklverylaeqamdr
ansyvigdratdiqlaenmginglrydretlnwpmigeql

SCOP Domain Coordinates for d2fpwb1:

Click to download the PDB-style file with coordinates for d2fpwb1.
(The format of our PDB-style files is described here.)

Timeline for d2fpwb1: