Lineage for d2fpwa1 (2fpw A:3-163)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 847927Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 847928Superfamily c.108.1: HAD-like [56784] (25 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 848312Family c.108.1.19: Histidinol phosphatase-like [142177] (3 proteins)
    no insertion subdomains
  6. 848319Protein Histidine biosynthesis bifunctional protein HisB, phosphatase domain [142178] (1 species)
  7. 848320Species Escherichia coli [TaxId:562] [142179] (5 PDB entries)
    Uniprot Q9S5G5 3-163
  8. 848321Domain d2fpwa1: 2fpw A:3-163 [133927]
    automatically matched to 2FPR A:3-163
    complexed with ca, phd, zn

Details for d2fpwa1

PDB Entry: 2fpw (more details), 1.75 Å

PDB Description: crystal structure of the n-terminal domain of e.coli hisb- phosphoaspartate intermediate.
PDB Compounds: (A:) Histidine biosynthesis bifunctional protein hisB

SCOP Domain Sequences for d2fpwa1:

Sequence, based on SEQRES records: (download)

>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]}
sqkylfidrdgtliseppsdfqvdrfdklafepgvipqllklqkagyklvmitnqdglgt
qsfpqadfdgphnlmmqiftsqgvqfdevlicphlpadecdcrkpkvklverylaeqamd
ransyvigdratdiqlaenmginglrydretlnwpmigeql

Sequence, based on observed residues (ATOM records): (download)

>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]}
sqkylfidrdgtlisepdfqvdrfdklafepgvipqllklqkagyklvmitnqdglgtqs
fpqadfdgphnlmmqiftsqgvqfdevlicphlpadecdcrkpkvklverylmdransyv
igdratdiqlaenmginglrydretlnwpmigeql

SCOP Domain Coordinates for d2fpwa1:

Click to download the PDB-style file with coordinates for d2fpwa1.
(The format of our PDB-style files is described here.)

Timeline for d2fpwa1: