SCOP 1.73: Domain d2fpwa1: 2fpw A:3-163

Lineage for d2fpwa1 (2fpw A:3-163)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (23 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.19: Histidinol phosphatase [142177] (1 protein)
   no insertion subdomains

6. Protein Histidine biosynthesis bifunctional protein HisB, phosphatase domain [142178] (1 species)

7. Species Escherichia coli [TaxId:562] [142179] (5 PDB entries)

8. Domain d2fpwa1: 2fpw A:3-163 [133927]
   automatically matched to 2FPR A:3-163
   complexed with ca, phd, zn

Details for d2fpwa1

PDB Entry: 2fpw, 1.75 Å

PDB Description: crystal structure of the n-terminal domain of e.coli hisb- phosphoaspartate intermediate.

PDB Compounds: (A:) Histidine biosynthesis bifunctional protein hisB

SCOP Domain Sequences for d2fpwa1:

Sequence, based on SEQRES records:

>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]}
sqkylfidrdgtliseppsdfqvdrfdklafepgvipqllklqkagyklvmitnqdglgt
qsfpqadfdgphnlmmqiftsqgvqfdevlicphlpadecdcrkpkvklverylaeqamd
ransyvigdratdiqlaenmginglrydretlnwpmigeql

Sequence, based on observed residues (ATOM records):

>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]}
sqkylfidrdgtlisepdfqvdrfdklafepgvipqllklqkagyklvmitnqdglgtqs
fpqadfdgphnlmmqiftsqgvqfdevlicphlpadecdcrkpkvklverylmdransyv
igdratdiqlaenmginglrydretlnwpmigeql

Timeline for d2fpwa1:

• d2fpwa1 is new in SCOP 1.73
  
• d2fpwa1 appears in SCOP 1.75
  
• d2fpwa1 appears in the current release, SCOPe 2.08, called d2fpwa_