Lineage for d2fpub_ (2fpu B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920176Family c.108.1.19: Histidinol phosphatase-like [142177] (3 proteins)
    no insertion subdomains
  6. 2920191Protein Histidine biosynthesis bifunctional protein HisB, phosphatase domain [142178] (1 species)
  7. 2920192Species Escherichia coli [TaxId:562] [142179] (5 PDB entries)
    Uniprot Q9S5G5 3-163
  8. 2920200Domain d2fpub_: 2fpu B: [133925]
    automated match to d2fpra1
    complexed with cl, hso, mg, zn

Details for d2fpub_

PDB Entry: 2fpu (more details), 1.8 Å

PDB Description: crystal structure of the n-terminal domain of e.coli hisb- complex with histidinol
PDB Compounds: (B:) Histidine biosynthesis bifunctional protein hisB

SCOPe Domain Sequences for d2fpub_:

Sequence, based on SEQRES records: (download)

>d2fpub_ c.108.1.19 (B:) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]}
qkylfidrdgtliseppsdfqvdrfdklafepgvipqllklqkagyklvmitnqdglgtq
sfpqadfdgphnlmmqiftsqgvqfdevlicphlpadecdcrkpkvklverylaeqamdr
ansyvigdratdiqlaenmginglrydretlnwpmigeqltrr

Sequence, based on observed residues (ATOM records): (download)

>d2fpub_ c.108.1.19 (B:) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]}
qkylfidrdgtliseppsdfqvdrfdklafepgvipqllklqkagyklvmitnqdglgtq
sfpqadfdgphnlmmqiftsqgvqfdevlicphlpadecdcrkpkvklverylamdrans
yvigdratdiqlaenmginglrydretlnwpmigeqltrr

SCOPe Domain Coordinates for d2fpub_:

Click to download the PDB-style file with coordinates for d2fpub_.
(The format of our PDB-style files is described here.)

Timeline for d2fpub_: