SCOP 1.73: Domain d2fpsb1: 2fps B:4-163

Lineage for d2fpsb1 (2fps B:4-163)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (23 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.19: Histidinol phosphatase [142177] (1 protein)
   no insertion subdomains

6. Protein Histidine biosynthesis bifunctional protein HisB, phosphatase domain [142178] (1 species)

7. Species Escherichia coli [TaxId:562] [142179] (5 PDB entries)

8. Domain d2fpsb1: 2fps B:4-163 [133922]
   automatically matched to 2FPR A:3-163
   complexed with ca, cl, zn

Details for d2fpsb1

PDB Entry: 2fps, 2.2 Å

PDB Description: crystal structure of the n-terminal domain of e.coli hisb- apo ca model.

PDB Compounds: (B:) Histidine biosynthesis bifunctional protein hisB

SCOP Domain Sequences for d2fpsb1:

Sequence; same for both SEQRES and ATOM records:

>d2fpsb1 c.108.1.19 (B:4-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]}
qkylfidrdgtliseppsdfqvdrfdklafepgvipqllklqkagyklvmitnqdglgtq
sfpqadfdgphnlmmqiftsqgvqfdevlicphlpadecdcrkpkvklverylaeqamdr
ansyvigdratdiqlaenmginglrydretlnwpmigeql

Timeline for d2fpsb1:

• d2fpsb1 is new in SCOP 1.73
  
• d2fpsb1 appears in SCOP 1.75
  
• d2fpsb1 appears in the current release, SCOPe 2.08, called d2fpsb_