SCOPe 2.07: Domain d2fpsa_: 2fps A:

Lineage for d2fpsa_ (2fps A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.19: Histidinol phosphatase-like [142177] (3 proteins)
   no insertion subdomains

6. Protein Histidine biosynthesis bifunctional protein HisB, phosphatase domain [142178] (1 species)

7. Species Escherichia coli [TaxId:562] [142179] (5 PDB entries)
   Uniprot Q9S5G5 3-163

8. Domain d2fpsa_: 2fps A: [133921]
   automated match to d2fpra1
   complexed with ca, cl, zn

Details for d2fpsa_

PDB Entry: 2fps, 2.2 Å

PDB Description: crystal structure of the n-terminal domain of e.coli hisb- apo ca model.

PDB Compounds: (A:) Histidine biosynthesis bifunctional protein hisB

SCOPe Domain Sequences for d2fpsa_:

Sequence, based on SEQRES records:

>d2fpsa_ c.108.1.19 (A:) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]}
sqkylfidrdgtliseppsdfqvdrfdklafepgvipqllklqkagyklvmitnqdglgt
qsfpqadfdgphnlmmqiftsqgvqfdevlicphlpadecdcrkpkvklverylaeqamd
ransyvigdratdiqlaenmginglrydretlnwpmigeqlt

Sequence, based on observed residues (ATOM records):

>d2fpsa_ c.108.1.19 (A:) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]}
sqkylfidrdgtliseppsdfqvdrfdklafepgvipqllklqkagyklvmitnqdglgt
qsfpqadfdgphnlmmqiftsqgvqfdevlicphlpadecdcrkpkvklverylmdrans
yvigdratdiqlaenmginglrydretlnwpmigeqlt

Timeline for d2fpsa_:

• d2fpsa_ first appeared in SCOP 1.73, called d2fpsa1
  
• d2fpsa_ appears in SCOPe 2.06
  
• d2fpsa_ appears in the current release, SCOPe 2.08