Lineage for d2fppb2 (2fpp B:1-245)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2978768Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein)
    automatically mapped to Pfam PF13549
    automatically mapped to Pfam PF08442
  6. 2978769Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (3 species)
  7. 2978797Species Pig (Sus scrofa) [TaxId:9823] [56084] (13 PDB entries)
    GTP-specific enzyme
  8. 2978810Domain d2fppb2: 2fpp B:1-245 [133918]
    Other proteins in same PDB: d2fppa1, d2fppa2, d2fppa3, d2fppb1
    automated match to d1eudb2
    complexed with cl, so4

Details for d2fppb2

PDB Entry: 2fpp (more details), 2.35 Å

PDB Description: crystal structure of pig gtp-specific succinyl-coa synthetase from polyethylene glycol with chloride ions
PDB Compounds: (B:) Succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial

SCOPe Domain Sequences for d2fppb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fppb2 d.142.1.4 (B:1-245) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mnlqeyqskklmsdngvkvqrffvadtanealeaakrlnakeivlkaqilaggrgkgvfs
sglkggvhltkdpevvgqlakqmigynlatkqtpkegvkvnkvmvaealdisretylail
mdrscngpvlvgspqggvdieevaasnpelifkeqidiiegikdsqaqrmaenlgflgpl
qnqaadqikklynlflkidatqvevnpfgetpegqvvcfdakinfddnaefrqkdifamd
dksen

SCOPe Domain Coordinates for d2fppb2:

Click to download the PDB-style file with coordinates for d2fppb2.
(The format of our PDB-style files is described here.)

Timeline for d2fppb2: