SCOPe 2.03: Domain d2fppb1: 2fpp B:246-393

Lineage for d2fppb1 (2fpp B:246-393)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families)

5. Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
   contain additional N-terminal strand "0", antiparallel to strand 2

6. Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [52217] (6 PDB entries)

8. Domain d2fppb1: 2fpp B:246-393 [133917]
   Other proteins in same PDB: d2fppa1, d2fppa2, d2fppb2
   automatically matched to d1eudb1
   complexed with cl, so4

Details for d2fppb1

PDB Entry: 2fpp, 2.35 Å

PDB Description: crystal structure of pig gtp-specific succinyl-coa synthetase from polyethylene glycol with chloride ions

PDB Compounds: (B:) Succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial

SCOPe Domain Sequences for d2fppb1:

Sequence; same for both SEQRES and ATOM records:

>d2fppb1 c.23.4.1 (B:246-393) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
epieneaakydlkyigldgniacfvngaglamatcdiiflnggkpanfldlgggvkesqv
yqafklltadpkveailvnifggivncaiiangitkacrelelkvplvvrlegtnvheaq
niltnsglpitsavdledaakkavasvt

Timeline for d2fppb1:

• d2fppb1 first appeared in SCOP 1.73
  
• d2fppb1 appears in SCOPe 2.02
  
• d2fppb1 appears in SCOPe 2.04
  
• d2fppb1 appears in the current release, SCOPe 2.08