Lineage for d2fppb1 (2fpp B:246-393)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 691887Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family) (S)
  5. 691888Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
    contain additional N-terminal strand "0", antiparallel to strand 2
  6. 691918Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (2 species)
  7. 691932Species Pig (Sus scrofa) [TaxId:9823] [52217] (6 PDB entries)
  8. 691935Domain d2fppb1: 2fpp B:246-393 [133917]
    Other proteins in same PDB: d2fppa1, d2fppa2, d2fppb2
    automatically matched to d1eudb1
    complexed with cl, so4

Details for d2fppb1

PDB Entry: 2fpp (more details), 2.35 Å

PDB Description: crystal structure of pig gtp-specific succinyl-coa synthetase from polyethylene glycol with chloride ions
PDB Compounds: (B:) Succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial

SCOP Domain Sequences for d2fppb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fppb1 c.23.4.1 (B:246-393) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
epieneaakydlkyigldgniacfvngaglamatcdiiflnggkpanfldlgggvkesqv
yqafklltadpkveailvnifggivncaiiangitkacrelelkvplvvrlegtnvheaq
niltnsglpitsavdledaakkavasvt

SCOP Domain Coordinates for d2fppb1:

Click to download the PDB-style file with coordinates for d2fppb1.
(The format of our PDB-style files is described here.)

Timeline for d2fppb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fppb2