| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) ![]() |
| Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins) contain additional N-terminal strand "0", antiparallel to strand 2 |
| Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (6 species) |
| Species Pig (Sus scrofa) [TaxId:9823] [52214] (13 PDB entries) |
| Domain d2fppa2: 2fpp A:131-306 [133916] Other proteins in same PDB: d2fppa1, d2fppa3, d2fppb1, d2fppb2 automated match to d1euda2 complexed with cl, so4 |
PDB Entry: 2fpp (more details), 2.35 Å
SCOPe Domain Sequences for d2fppa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fppa2 c.23.4.1 (A:131-306) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
ncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgqslcvgiggdp
fngtdftdcleiflndpategiiligeiggnaeenaaeflkqhnsgpkskpvvsfiaglt
appgrrmghagaiiaggkggakekitalqsagvvvsmspaqlgttiykefekrkml
Timeline for d2fppa2: