Lineage for d2fppa2 (2fpp A:131-306)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856236Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) (S)
  5. 2856237Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
    contain additional N-terminal strand "0", antiparallel to strand 2
  6. 2856244Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (6 species)
  7. 2856277Species Pig (Sus scrofa) [TaxId:9823] [52214] (13 PDB entries)
  8. 2856290Domain d2fppa2: 2fpp A:131-306 [133916]
    Other proteins in same PDB: d2fppa1, d2fppa3, d2fppb1, d2fppb2
    automated match to d1euda2
    complexed with cl, so4

Details for d2fppa2

PDB Entry: 2fpp (more details), 2.35 Å

PDB Description: crystal structure of pig gtp-specific succinyl-coa synthetase from polyethylene glycol with chloride ions
PDB Compounds: (A:) Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial

SCOPe Domain Sequences for d2fppa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fppa2 c.23.4.1 (A:131-306) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
ncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgqslcvgiggdp
fngtdftdcleiflndpategiiligeiggnaeenaaeflkqhnsgpkskpvvsfiaglt
appgrrmghagaiiaggkggakekitalqsagvvvsmspaqlgttiykefekrkml

SCOPe Domain Coordinates for d2fppa2:

Click to download the PDB-style file with coordinates for d2fppa2.
(The format of our PDB-style files is described here.)

Timeline for d2fppa2: