SCOPe 2.02: Domain d2fppa1: 2fpp A:2-130

Lineage for d2fppa1 (2fpp A:2-130)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.8: CoA-binding domain [51900] (6 proteins)

6. Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (3 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [51903] (6 PDB entries)

8. Domain d2fppa1: 2fpp A:2-130 [133915]
   Other proteins in same PDB: d2fppa2, d2fppb1, d2fppb2
   automatically matched to d1euca1
   complexed with cl, so4

Details for d2fppa1

PDB Entry: 2fpp, 2.35 Å

PDB Description: crystal structure of pig gtp-specific succinyl-coa synthetase from polyethylene glycol with chloride ions

PDB Compounds: (A:) Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial

SCOPe Domain Sequences for d2fppa1:

Sequence; same for both SEQRES and ATOM records:

>d2fppa1 c.2.1.8 (A:2-130) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Pig (Sus scrofa) [TaxId: 9823]}
sytasrkhlyvdkntkvicqgftgkqgtfhsqqaleygtnlvggttpgkggkthlglpvf
ntvkeakeqtgatasviyvpppfaaaaineaidaevplvvcitegipqqdmvrvkhrllr
qgktrligp

Timeline for d2fppa1:

• d2fppa1 first appeared in SCOP 1.73
  
• d2fppa1 appears in SCOPe 2.01
  
• d2fppa1 appears in SCOPe 2.03
  
• d2fppa1 appears in the current release, SCOPe 2.08