Lineage for d2fpoe_ (2fpo E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894111Family c.66.1.46: YhhF-like [142611] (6 proteins)
    Pfam PF03602
  6. 2894112Protein Methylase YhhF [142620] (1 species)
  7. 2894113Species Escherichia coli [TaxId:562] [142621] (1 PDB entry)
    Uniprot P0ADX9 10-192
  8. 2894118Domain d2fpoe_: 2fpo E: [133913]
    automated match to d2fpoa1
    complexed with cl, edo

Details for d2fpoe_

PDB Entry: 2fpo (more details), 2.05 Å

PDB Description: Putative methyltransferase yhhF from Escherichia coli.
PDB Compounds: (E:) methylase yhhF

SCOPe Domain Sequences for d2fpoe_:

Sequence, based on SEQRES records: (download)

>d2fpoe_ c.66.1.46 (E:) Methylase YhhF {Escherichia coli [TaxId: 562]}
gqiriiggqwrgrklpvpdspglrpttdrvretlfnwlapvivdaqcldcfagsgalgle
alsryaagatliemdravsqqliknlatlkagnarvvnsnamsflaqkgtphnivfvdpp
frrglleetinlledngwladealiyvesevenglptvpanwslhrekvagqvayrlyqr
eaq

Sequence, based on observed residues (ATOM records): (download)

>d2fpoe_ c.66.1.46 (E:) Methylase YhhF {Escherichia coli [TaxId: 562]}
gqiriiggqwrgrklpvpdsptdrvretlfnwlapvivdaqcldcfagsgalglealsry
aagatliemdravsqqliknlatlkagnarvvnsnamsflaqkgtphnivfvdppfrrgl
leetinlledngwladealiyvesevenglptvpanwslhrekvagqvayrlyqreaq

SCOPe Domain Coordinates for d2fpoe_:

Click to download the PDB-style file with coordinates for d2fpoe_.
(The format of our PDB-style files is described here.)

Timeline for d2fpoe_: