Lineage for d2fpna1 (2fpn A:1-214)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538746Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2539644Superfamily d.129.10: YwmB-like [143842] (1 family) (S)
    duplication: tandem repeat of two circularly permuted motifs, alpha-beta-alpha-beta(4), assembled as in the TATA-box binding domain; forms a swapped dimer by exchanging the equivalent parts of the C-terminal motifs
    automatically mapped to Pfam PF08680
  5. 2539645Family d.129.10.1: YwmB-like [143843] (1 protein)
  6. 2539646Protein Hypothetical protein YwmB [143844] (1 species)
  7. 2539647Species Bacillus subtilis [TaxId:1423] [143845] (1 PDB entry)
    Uniprot O32277 31-244
  8. 2539648Domain d2fpna1: 2fpn A:1-214 [133908]

Details for d2fpna1

PDB Entry: 2fpn (more details), 2.49 Å

PDB Description: The crystal structure of the ywmB protein from Bacillus subtilis
PDB Compounds: (A:) ywmB

SCOPe Domain Sequences for d2fpna1:

Sequence, based on SEQRES records: (download)

>d2fpna1 d.129.10.1 (A:1-214) Hypothetical protein YwmB {Bacillus subtilis [TaxId: 1423]}
ltplaqmaegmerqdvsidkwtlhakqnlsltekefyqkvqrlkqeyrqydwviaredkm
ikaigtytdkknrtsfrlqlvttlkkhnptsyllyeqmsletpdswndtyeqferetlgi
fqekvviftclnghlddnmnivlqkkanqllnefqarsvehvvepnfvsisaftdeweey
imtskhkmnlqialrsagmggkhtvtvgtpivtt

Sequence, based on observed residues (ATOM records): (download)

>d2fpna1 d.129.10.1 (A:1-214) Hypothetical protein YwmB {Bacillus subtilis [TaxId: 1423]}
ltplaqmaegmerqdvsidkwtlhakqnlsltekefyqkvqrlkqeyrqydwviaredkm
ikaigtytdkknrtsfrlqlvttlkkhnptsyllyeqmsletpdswndtyeqferetlgi
fqekvviftclnghlddnmnivlqkkanqllnefqvehvvepnfvsisaftdeweeyimt
skhkmnlqialrshtvtvgtpivtt

SCOPe Domain Coordinates for d2fpna1:

Click to download the PDB-style file with coordinates for d2fpna1.
(The format of our PDB-style files is described here.)

Timeline for d2fpna1: