SCOPe 2.03: Domain d2fpia2: 2fpi A:131-306

Lineage for d2fpia2 (2fpi A:131-306)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families)

5. Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
   contain additional N-terminal strand "0", antiparallel to strand 2

6. Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (5 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [52214] (6 PDB entries)

8. Domain d2fpia2: 2fpi A:131-306 [133905]
   Other proteins in same PDB: d2fpia1, d2fpib1, d2fpib2
   automatically matched to d1euca2
   complexed with so4

Details for d2fpia2

PDB Entry: 2fpi, 2.7 Å

PDB Description: crystal structure of pig gtp-specific succinyl-coa synthetase from polyethylene glycol

PDB Compounds: (A:) Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial

SCOPe Domain Sequences for d2fpia2:

Sequence; same for both SEQRES and ATOM records:

>d2fpia2 c.23.4.1 (A:131-306) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
ncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgqslcvgiggdp
fngtdftdcleiflndpategiiligeiggnaeenaaeflkqhnsgpkskpvvsfiaglt
appgrrmghagaiiaggkggakekitalqsagvvvsmspaqlgttiykefekrkml

Timeline for d2fpia2:

• d2fpia2 first appeared in SCOP 1.73
  
• d2fpia2 appears in SCOPe 2.02
  
• d2fpia2 appears in SCOPe 2.04
  
• d2fpia2 appears in the current release, SCOPe 2.08