![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (8 families) ![]() |
![]() | Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein) |
![]() | Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (2 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [56084] (6 PDB entries) GTP-specific enzyme |
![]() | Domain d2fpgb2: 2fpg B:1-245 [133903] Other proteins in same PDB: d2fpga1, d2fpga2, d2fpgb1 automatically matched to d1eucb2 complexed with gdp, k, po4 |
PDB Entry: 2fpg (more details), 2.96 Å
SCOP Domain Sequences for d2fpgb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fpgb2 d.142.1.4 (B:1-245) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} mnlqeyqskklmsdngvkvqrffvadtanealeaakrlnakeivlkaqilaggrgkgvfs sglkggvhltkdpevvgqlakqmigynlatkqtpkegvkvnkvmvaealdisretylail mdrscngpvlvgspqggvdieevaasnpelifkeqidiiegikdsqaqrmaenlgflgpl qnqaadqikklynlflkidatqvevnpfgetpegqvvcfdakinfddnaefrqkdifamd dksen
Timeline for d2fpgb2: