Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein) automatically mapped to Pfam PF13549 automatically mapped to Pfam PF08442 |
Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (3 species) |
Species Pig (Sus scrofa) [TaxId:9823] [56084] (13 PDB entries) GTP-specific enzyme |
Domain d2fpgb2: 2fpg B:1-245 [133903] Other proteins in same PDB: d2fpga1, d2fpga2, d2fpga3, d2fpgb1 automated match to d1eudb2 complexed with gdp, k, po4 |
PDB Entry: 2fpg (more details), 2.96 Å
SCOPe Domain Sequences for d2fpgb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fpgb2 d.142.1.4 (B:1-245) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} mnlqeyqskklmsdngvkvqrffvadtanealeaakrlnakeivlkaqilaggrgkgvfs sglkggvhltkdpevvgqlakqmigynlatkqtpkegvkvnkvmvaealdisretylail mdrscngpvlvgspqggvdieevaasnpelifkeqidiiegikdsqaqrmaenlgflgpl qnqaadqikklynlflkidatqvevnpfgetpegqvvcfdakinfddnaefrqkdifamd dksen
Timeline for d2fpgb2: