Lineage for d2fpgb1 (2fpg B:246-393)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1587262Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) (S)
  5. 1587263Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
    contain additional N-terminal strand "0", antiparallel to strand 2
  6. 1587309Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (2 species)
  7. 1587335Species Pig (Sus scrofa) [TaxId:9823] [52217] (6 PDB entries)
  8. 1587341Domain d2fpgb1: 2fpg B:246-393 [133902]
    Other proteins in same PDB: d2fpga1, d2fpga2, d2fpgb2
    automated match to d1eucb1
    complexed with gdp, k, po4

Details for d2fpgb1

PDB Entry: 2fpg (more details), 2.96 Å

PDB Description: crystal structure of pig gtp-specific succinyl-coa synthetase in complex with gdp
PDB Compounds: (B:) Succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial

SCOPe Domain Sequences for d2fpgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fpgb1 c.23.4.1 (B:246-393) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
epieneaakydlkyigldgniacfvngaglamatcdiiflnggkpanfldlgggvkesqv
yqafklltadpkveailvnifggivncaiiangitkacrelelkvplvvrlegtnvheaq
niltnsglpitsavdledaakkavasvt

SCOPe Domain Coordinates for d2fpgb1:

Click to download the PDB-style file with coordinates for d2fpgb1.
(The format of our PDB-style files is described here.)

Timeline for d2fpgb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fpgb2