SCOP 1.75: Domain d2fpgb1: 2fpg B:246-393

Lineage for d2fpgb1 (2fpg B:246-393)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family)

5. Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
   contain additional N-terminal strand "0", antiparallel to strand 2

6. Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [52217] (6 PDB entries)

8. Domain d2fpgb1: 2fpg B:246-393 [133902]
   Other proteins in same PDB: d2fpga1, d2fpga2, d2fpgb2
   automatically matched to d1eudb1
   complexed with gdp, k, po4

Details for d2fpgb1

PDB Entry: 2fpg, 2.96 Å

PDB Description: crystal structure of pig gtp-specific succinyl-coa synthetase in complex with gdp

PDB Compounds: (B:) Succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial

SCOP Domain Sequences for d2fpgb1:

Sequence; same for both SEQRES and ATOM records:

>d2fpgb1 c.23.4.1 (B:246-393) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
epieneaakydlkyigldgniacfvngaglamatcdiiflnggkpanfldlgggvkesqv
yqafklltadpkveailvnifggivncaiiangitkacrelelkvplvvrlegtnvheaq
niltnsglpitsavdledaakkavasvt

Timeline for d2fpgb1:

• d2fpgb1 first appeared in SCOP 1.73
  
• d2fpgb1 appears in SCOPe 2.01
  
• d2fpgb1 appears in the current release, SCOPe 2.08