Lineage for d2fpga2 (2fpg A:131-306)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1158036Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1158469Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family) (S)
  5. 1158470Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
    contain additional N-terminal strand "0", antiparallel to strand 2
  6. 1158477Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (3 species)
  7. 1158503Species Pig (Sus scrofa) [TaxId:9823] [52214] (6 PDB entries)
  8. 1158509Domain d2fpga2: 2fpg A:131-306 [133901]
    Other proteins in same PDB: d2fpga1, d2fpgb1, d2fpgb2
    automatically matched to d1euca2
    complexed with gdp, k, po4

Details for d2fpga2

PDB Entry: 2fpg (more details), 2.96 Å

PDB Description: crystal structure of pig gtp-specific succinyl-coa synthetase in complex with gdp
PDB Compounds: (A:) Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial

SCOPe Domain Sequences for d2fpga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fpga2 c.23.4.1 (A:131-306) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
ncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgqslcvgiggdp
fngtdftdcleiflndpategiiligeiggnaeenaaeflkqhnsgpkskpvvsfiaglt
appgrrmghagaiiaggkggakekitalqsagvvvsmspaqlgttiykefekrkml

SCOPe Domain Coordinates for d2fpga2:

Click to download the PDB-style file with coordinates for d2fpga2.
(The format of our PDB-style files is described here.)

Timeline for d2fpga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fpga1