SCOPe 2.08: Domain d2fpga2: 2fpg A:131-306

Lineage for d2fpga2 (2fpg A:131-306)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families)

5. Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
   contain additional N-terminal strand "0", antiparallel to strand 2

6. Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (6 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [52214] (13 PDB entries)

8. Domain d2fpga2: 2fpg A:131-306 [133901]
   Other proteins in same PDB: d2fpga1, d2fpga3, d2fpgb1, d2fpgb2
   automated match to d1euda2
   complexed with gdp, k, po4

Details for d2fpga2

PDB Entry: 2fpg, 2.96 Å

PDB Description: crystal structure of pig gtp-specific succinyl-coa synthetase in complex with gdp

PDB Compounds: (A:) Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial

SCOPe Domain Sequences for d2fpga2:

Sequence; same for both SEQRES and ATOM records:

>d2fpga2 c.23.4.1 (A:131-306) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
ncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgqslcvgiggdp
fngtdftdcleiflndpategiiligeiggnaeenaaeflkqhnsgpkskpvvsfiaglt
appgrrmghagaiiaggkggakekitalqsagvvvsmspaqlgttiykefekrkml

Timeline for d2fpga2:

• d2fpga2 first appeared in SCOP 1.73
  
• d2fpga2 appears in SCOPe 2.07