Lineage for d2fpga1 (2fpg A:3-130)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845549Family c.2.1.8: CoA-binding domain [51900] (6 proteins)
  6. 2845567Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (6 species)
  7. 2845600Species Pig (Sus scrofa) [TaxId:9823] [51903] (13 PDB entries)
  8. 2845615Domain d2fpga1: 2fpg A:3-130 [133900]
    Other proteins in same PDB: d2fpga2, d2fpga3, d2fpgb1, d2fpgb2
    automated match to d1euda1
    complexed with gdp, k, po4

Details for d2fpga1

PDB Entry: 2fpg (more details), 2.96 Å

PDB Description: crystal structure of pig gtp-specific succinyl-coa synthetase in complex with gdp
PDB Compounds: (A:) Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial

SCOPe Domain Sequences for d2fpga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fpga1 c.2.1.8 (A:3-130) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Pig (Sus scrofa) [TaxId: 9823]}
ytasrkhlyvdkntkvicqgftgkqgtfhsqqaleygtnlvggttpgkggkthlglpvfn
tvkeakeqtgatasviyvpppfaaaaineaidaevplvvcitegipqqdmvrvkhrllrq
gktrligp

SCOPe Domain Coordinates for d2fpga1:

Click to download the PDB-style file with coordinates for d2fpga1.
(The format of our PDB-style files is described here.)

Timeline for d2fpga1: