SCOPe 2.03: Domain d2fp4b2: 2fp4 B:1-245

Lineage for d2fp4b2 (2fp4 B:1-245)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families)

5. Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein)
   automatically mapped to Pfam PF13549
   automatically mapped to Pfam PF08442

6. Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [56084] (6 PDB entries)
   GTP-specific enzyme

8. Domain d2fp4b2: 2fp4 B:1-245 [133898]
   Other proteins in same PDB: d2fp4a1, d2fp4a2, d2fp4b1
   automatically matched to d1eucb2
   complexed with gtp, k, mg

Details for d2fp4b2

PDB Entry: 2fp4, 2.08 Å

PDB Description: Crystal structure of pig GTP-specific succinyl-CoA synthetase in complex with GTP

PDB Compounds: (B:) Succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial

SCOPe Domain Sequences for d2fp4b2:

Sequence; same for both SEQRES and ATOM records:

>d2fp4b2 d.142.1.4 (B:1-245) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mnlqeyqskklmsdngvkvqrffvadtanealeaakrlnakeivlkaqilaggrgkgvfs
sglkggvhltkdpevvgqlakqmigynlatkqtpkegvkvnkvmvaealdisretylail
mdrscngpvlvgspqggvdieevaasnpelifkeqidiiegikdsqaqrmaenlgflgpl
qnqaadqikklynlflkidatqvevnpfgetpegqvvcfdakinfddnaefrqkdifamd
dksen

Timeline for d2fp4b2:

• d2fp4b2 first appeared in SCOP 1.73
  
• d2fp4b2 appears in SCOPe 2.02
  
• d2fp4b2 appears in SCOPe 2.04
  
• d2fp4b2 appears in the current release, SCOPe 2.08