Lineage for d2fp4b2 (2fp4 B:1-245)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein)
    automatically mapped to Pfam PF13549
    automatically mapped to Pfam PF08442
  6. Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (3 species)
  7. Species Pig (Sus scrofa) [TaxId:9823] [56084] (13 PDB entries)
    GTP-specific enzyme
  8. Domain d2fp4b2: 2fp4 B:1-245 [133898]
    Other proteins in same PDB: d2fp4a1, d2fp4a2, d2fp4a3, d2fp4b1
    automated match to d1eudb2
    complexed with gtp, k, mg

Details for d2fp4b2

PDB Entry: 2fp4 (more details), 2.08 Å

PDB Description: Crystal structure of pig GTP-specific succinyl-CoA synthetase in complex with GTP
PDB Compounds: (B:) Succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial

SCOPe Domain Sequences for d2fp4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fp4b2 d.142.1.4 (B:1-245) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mnlqeyqskklmsdngvkvqrffvadtanealeaakrlnakeivlkaqilaggrgkgvfs
sglkggvhltkdpevvgqlakqmigynlatkqtpkegvkvnkvmvaealdisretylail
mdrscngpvlvgspqggvdieevaasnpelifkeqidiiegikdsqaqrmaenlgflgpl
qnqaadqikklynlflkidatqvevnpfgetpegqvvcfdakinfddnaefrqkdifamd
dksen

SCOPe Domain Coordinates for d2fp4b2 are not available.

Timeline for d2fp4b2:

Domains from same chain:
(mouse over for more information)
d2fp4b1
Domains from other chains:
(mouse over for more information)
d2fp4a1, d2fp4a2, d2fp4a3