SCOPe 2.05: Domain d2fp2b_: 2fp2 B:

Lineage for d2fp2b_ (2fp2 B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.130: Chorismate mutase II [48599] (1 superfamily)
   multihelical; core: 6 helices, bundle

4. Superfamily a.130.1: Chorismate mutase II [48600] (5 families)

5. Family a.130.1.4: Secreted chorismate mutase-like [140945] (1 protein)
   duplication; two structural repeats, like in the yeast enzyme, but with a different location of the remaining active site

6. Protein Secreted chorismate mutase [140946] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [140947] (4 PDB entries)
   Uniprot O07746 34-199

8. Domain d2fp2b_: 2fp2 B: [133894]
   automated match to d2f6la1
   complexed with tsa

Details for d2fp2b_

PDB Entry: 2fp2, 1.64 Å

PDB Description: secreted chorismate mutase from mycobacterium tuberculosis

PDB Compounds: (B:) chorismate mutase

SCOPe Domain Sequences for d2fp2b_:

Sequence; same for both SEQRES and ATOM records:

>d2fp2b_ a.130.1.4 (B:) Secreted chorismate mutase {Mycobacterium tuberculosis [TaxId: 1773]}
sqlaelvdaaaerlevadpvaafkwraqlpiedsgrveqqlaklgedarsqhidpdyvtr
vfddqirateaieysrfsdwklnpasappeppdlsasrsaidslnnrmlsqiwshwslls
apscaaqldrakrdivrsrhldslyqralttatqsycqalppa

Timeline for d2fp2b_:

• d2fp2b_ first appeared in SCOP 1.73, called d2fp2b1
  
• d2fp2b_ appears in SCOPe 2.04
  
• d2fp2b_ appears in SCOPe 2.06
  
• d2fp2b_ appears in the current release, SCOPe 2.08