SCOPe 2.01: Domain d2fp1a_: 2fp1 A:

Lineage for d2fp1a_ (2fp1 A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.130: Chorismate mutase II [48599] (1 superfamily)
   multihelical; core: 6 helices, bundle

4. Superfamily a.130.1: Chorismate mutase II [48600] (4 families)

5. Family a.130.1.4: Secreted chorismate mutase-like [140945] (1 protein)
   duplication; two structural repeats, like in the yeast enzyme, but with a different location of the remaining active site

6. Protein Secreted chorismate mutase [140946] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [140947] (4 PDB entries)
   Uniprot O07746 34-199

8. Domain d2fp1a_: 2fp1 A: [133891]
   automated match to d2f6la1
   complexed with pb

Details for d2fp1a_

PDB Entry: 2fp1, 1.55 Å

PDB Description: Secreted Chorismate Mutase from Mycobacterium tuberculosis

PDB Compounds: (A:) chorismate mutase

SCOPe Domain Sequences for d2fp1a_:

Sequence; same for both SEQRES and ATOM records:

>d2fp1a_ a.130.1.4 (A:) Secreted chorismate mutase {Mycobacterium tuberculosis [TaxId: 1773]}
gtsqlaelvdaaaerlevadpvaafkwraqlpiedsgrveqqlaklgedarsqhidpdyv
trvfddqirateaieysrfsdwklnpasappeppdlsasrsaidslnnrmlsqiwshwsl
lsapscaaqldrakrdivrsrhldslyqralttatqsycqalppa

Timeline for d2fp1a_:

• d2fp1a_ first appeared in SCOP 1.73, called d2fp1a1
  
• d2fp1a_ was called d2fp1a1 in SCOP 1.75
  
• d2fp1a_ appears in SCOPe 2.02
  
• d2fp1a_ appears in the current release, SCOPe 2.08