Lineage for d2foyb_ (2foy B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2067964Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2067965Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2067966Family b.74.1.1: Carbonic anhydrase [51070] (2 protein domains)
    automatically mapped to Pfam PF00194
  6. 2067967Protein Carbonic anhydrase [51071] (10 species)
  7. 2067975Species Human (Homo sapiens), erythrocytes, isozyme I [TaxId:9606] [51072] (18 PDB entries)
  8. 2067980Domain d2foyb_: 2foy B: [133890]
    automated match to d1bzm__
    complexed with b30, zn

Details for d2foyb_

PDB Entry: 2foy (more details), 1.55 Å

PDB Description: human carbonic anhydrase i complexed with a two-prong inhibitor
PDB Compounds: (B:) Carbonic anhydrase 1

SCOPe Domain Sequences for d2foyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2foyb_ b.74.1.1 (B:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I [TaxId: 9606]}
dwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvg
hsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahw
nsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpst
llpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqh
nnrptqplkgrtvrasf

SCOPe Domain Coordinates for d2foyb_:

Click to download the PDB-style file with coordinates for d2foyb_.
(The format of our PDB-style files is described here.)

Timeline for d2foyb_: