![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
![]() | Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) ![]() |
![]() | Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins) automatically mapped to Pfam PF00194 |
![]() | Protein Carbonic anhydrase [51071] (10 species) |
![]() | Species Human (Homo sapiens), erythrocytes, isozyme I [TaxId:9606] [51072] (18 PDB entries) |
![]() | Domain d2foyb_: 2foy B: [133890] automated match to d1bzm__ complexed with b30, zn |
PDB Entry: 2foy (more details), 1.55 Å
SCOPe Domain Sequences for d2foyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2foyb_ b.74.1.1 (B:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I [TaxId: 9606]} dwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvg hsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahw nsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpst llpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqh nnrptqplkgrtvrasf
Timeline for d2foyb_: