Lineage for d2fomb1 (2fom B:18-167)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2406625Family b.47.1.3: Viral proteases [50596] (5 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 2406626Protein NS3 protease [50600] (5 species)
  7. 2406631Species Dengue virus type 2 [TaxId:11060] [50602] (1 PDB entry)
  8. 2406632Domain d2fomb1: 2fom B:18-167 [133884]
    Other proteins in same PDB: d2foma1, d2foma2, d2foma3
    complexed with NS2B peptide cofactor
    complexed with cl, gol

Details for d2fomb1

PDB Entry: 2fom (more details), 1.5 Å

PDB Description: dengue virus ns2b/ns3 protease
PDB Compounds: (B:) Polyprotein

SCOPe Domain Sequences for d2fomb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fomb1 b.47.1.3 (B:18-167) NS3 protease {Dengue virus type 2 [TaxId: 11060]}
ledgayrikqkgilgysqigagvykegtfhtmwhvtrgavlmhkgkriepswadvkkdli
sygggwklegewkegeevqvlalepgknpravqtkpglfktntgtigavsldfspgtsgs
pivdkkgkvvglygngvvtrsgayvsaian

SCOPe Domain Coordinates for d2fomb1:

Click to download the PDB-style file with coordinates for d2fomb1.
(The format of our PDB-style files is described here.)

Timeline for d2fomb1: