Lineage for d2fofa_ (2fof A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1793331Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 1793723Protein Elastase [50536] (4 species)
  7. 1793740Species Pig (Sus scrofa) [TaxId:9823] [50538] (117 PDB entries)
  8. 1793839Domain d2fofa_: 2fof A: [133880]
    automated match to d1b0ea_
    complexed with ca, ipa, so4

Details for d2fofa_

PDB Entry: 2fof (more details), 2.2 Å

PDB Description: structure of porcine pancreatic elastase in 80% isopropanol
PDB Compounds: (A:) Elastase-1

SCOPe Domain Sequences for d2fofa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fofa_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

SCOPe Domain Coordinates for d2fofa_:

Click to download the PDB-style file with coordinates for d2fofa_.
(The format of our PDB-style files is described here.)

Timeline for d2fofa_: