SCOP 1.73: Domain d2foda1: 2fod A:16-255

Lineage for d2foda1 (2fod A:16-255)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Elastase [50536] (4 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50538] (91 PDB entries)

8. Domain d2foda1: 2fod A:16-255 [133878]
   automatically matched to d1esb__
   complexed with ca, eoh, so4

Details for d2foda1

PDB Entry: 2fod, 2 Å

PDB Description: Structure of porcine pancreatic elastase in 80% ethanol

PDB Compounds: (A:) Elastase-1

SCOP Domain Sequences for d2foda1:

Sequence; same for both SEQRES and ATOM records:

>d2foda1 b.47.1.2 (A:16-255) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

Timeline for d2foda1:

• d2foda1 is new in SCOP 1.73
  
• d2foda1 appears in SCOP 1.75
  
• d2foda1 appears in the current release, SCOPe 2.08, called d2foda_