SCOPe 2.07: Domain d2foba_: 2fob A:

Lineage for d2foba_ (2fob A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Elastase [50536] (4 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50538] (123 PDB entries)

8. Domain d2foba_: 2fob A: [133876]
   automated match to d1b0ea_
   complexed with ca, ipa, so4

Details for d2foba_

PDB Entry: 2fob, 1.9 Å

PDB Description: structure of porcine pancreatic elastase in 40/50/10 cyclohexane

PDB Compounds: (A:) Elastase-1

SCOPe Domain Sequences for d2foba_:

Sequence; same for both SEQRES and ATOM records:

>d2foba_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

Timeline for d2foba_:

• d2foba_ first appeared in SCOP 1.73, called d2foba1
  
• d2foba_ appears in SCOPe 2.06
  
• d2foba_ appears in the current release, SCOPe 2.08